PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000812G0550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB
Protein Properties Length: 1025aa    MW: 112449 Da    PI: 5.0307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000812G0550genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.19.8e-095076127
                     TSSS-HHHHHHHHHHHHHTTTT-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktI 27
                     +g+WT+eEd +l +av+ + g++Wk+I
  PH01000812G0550 50 KGNWTPEEDAILSRAVQTYKGKNWKKI 76
                     79************************9 PP

2Myb_DNA-binding59.28.8e-19119165148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++ + v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  PH01000812G0550 119 KGPWSKEEDEIITQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 165
                      79******************************.*************97 PP

3Myb_DNA-binding44.14.8e-14171213145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++++G++ W+   + +  gRt++ +k++w+
  PH01000812G0550 171 KDAWTQEEEITLIHAHRMYGNK-WAELTKILR-GRTDNAIKNHWN 213
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.14445113IPR017877Myb-like domain
SuperFamilySSF466891.22E-54778IPR009057Homeodomain-like
SMARTSM007170.0484992IPR001005SANT/Myb domain
PfamPF002491.8E-65076IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-1151125IPR009057Homeodomain-like
PROSITE profilePS5129431.18114169IPR017930Myb domain
SuperFamilySSF466895.62E-30116212IPR009057Homeodomain-like
SMARTSM007174.8E-18118167IPR001005SANT/Myb domain
CDDcd001671.10E-15121165No hitNo description
PfamPF139219.9E-18122182No hitNo description
Gene3DG3DSA:1.10.10.608.8E-27126173IPR009057Homeodomain-like
PROSITE profilePS5129418.461170220IPR017930Myb domain
SMARTSM007178.5E-13170218IPR001005SANT/Myb domain
CDDcd001677.61E-10173213No hitNo description
Gene3DG3DSA:1.10.10.602.9E-19174220IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MTSDKGKASK NGGEASGLSS APHEGEVSNE PQRRRSLNGR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYKG KNWKKIGIAY LIYLCFHSCF STICFPFLLM RTPPCVLSWQ KVLNPELVKG  120
PWSKEEDEII TQMVNKYGPK KWSTIAQALP GRIGKQCRER WHNHLNPGIN KDAWTQEEEI  180
TLIHAHRMYG NKWAELTKIL RGRTDNAIKN HWNSSVKKKV DSYMSSGLLA QAPCLPLIEY  240
PAHCNSSSVM IQQNSEDNGS NAVQEVEDSS GCSQSLDTVS CSQVQNANVA LGCDLQVNVE  300
ANKKEAQDSH SSMCQEACYT STEAVASALP EVHYHVSSSN FDPDKLLQQE FAQRMNLQMD  360
IDEVPSNSMF VDNKTICSTE NHERSLVPYD AAPVMPISML PSVSGAEQKP DFMSEANFNS  420
PNCLKSELWQ DISLQSLLSG PDAIDADSFS RLNHQPYAYS SKVDTNFLTP PYPLHTSNPS  480
SMMGTAYAQS PLMPVPPSHI CSNGLPDALD NTADPREMPV SQAEMVIHTN NSFGDAEQSA  540
NPGSSDCGHG ASAMMESIPE YRDQQLTDAE EPGTNSTAKE TSLTQSEAAS DEKVDGALFY  600
EPPRFPSLDV PFVSCDLVTS GDLQEYSPLG IRQLMRSTMN VTTPLRLWGS PTHDESPDVV  660
LKSAAKSFIC TPSILKKRQR DLLSPIPDKR IEKKSVTGKD GGVSDTSSIS TQTCCMNATI  720
NEAIVIESVF CTERSVSSKP LEKKLEFSDE NKENLDETTE QAKEGRNAGN EQPVDKEARG  780
EQYSATNIVN TNNDLPENLQ PAGILVEHNG IDPPDHGANA INQKINTNPE SLLACKEGMY  840
PKSKPAELIV EKSSPCINVD YEYVNLLADT PGVKRGLESP SAWKSPWFID MQFQGSYFVS  900
PGDRTYDALG LVKQINVHSA AALAEAREVL ASGNRCDDRN SDKENRGNTD AKKEPGTSKL  960
QTKVMAEARV LDFNECTTPV RSAGNKLSGS LDRSASWHLI ESLTSCFHCL DAAYMLGAYS  1020
RPVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-54502206159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-54502206159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230653.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLQ2QV960.0Q2QV96_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGLOC_Os12g13570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.24e-93myb domain protein 3r-4